Instruction and Safety Manual
for Gasoline Power Cuts
DPC7331HD
DPC7341HD
WARNING!
Read and understand this Manual. Always follow safety precautions in the Instruction and
Safety Manual. Improper use can cause serious injury!
The engine exhaust from this product contains chemicals known to the State of California to cause
cancer, birth defects or other reproductive harm. Preserve this Manual carefully!
Download from Www.Somanuals.com. All Manuals Search And Download.
Thank you for purchasing a MAKITA product!
Table of contents
Page
Congratulations on choosing a MAKITA Power Cut cutoff saw!
We are confident that you will be satisfied with this modern
piece of equipment. Like our chain saws, the MAKITA Power
Cuts feature specially designed high-performance engines
with outstanding power-to-weight ratios, for heavy-duty yet
lightweight tools.
Packing ................................................................................ꢁ
Delivery inventory ..............................................................4
Symbols ...............................................................................4
SAFETY PRECAUTIONS
Intended use ...................................................................5
General precautions .......................................................5
Protective equipment ...................................................5-6
Fuels / Refuelling ............................................................6
Putting into operation ......................................................6
Cutting discs ...................................................................7
Kickback and lock-in .......................................................8
Working behavior / Method of working ............................8
Cutting metal ...................................................................9
Cutting masonry and concrete ...................................9-10
Transport and storage ...................................................10
Maintenance ................................................................. 11
First aid ......................................................................... 11
Technical data ...................................................................1ꢀ
Denomination of components .........................................1ꢀ
Other advantages of the MAKITA Power Cuts:
• Sturdy construction and high reliability.
• Maintenance-free electronic ignition, hermetically sealed to
protect against dust and moisture.
• VibrationdampingwiththeMAKITAꢀ-masssystem(DꢀM)for
tireless working even when guiding the Power Cut by hand.
• Five-stage air-filter system for reliable working even under
very dusty conditions.
• Two options for mounting the cutter attachment: Either cen-
trally, for good balance when guiding the unit manually, or on
the side, for flush cuts along walls or curbsides or horizontally
directly above the ground.
• Extensive range of resin-bonded and diamond grit cutting
discs, trolley with dust catcher, and systems for supplying
water to the disc.
PUTTING INTO OPERATION
Mounting the cutting disc...............................................1ꢁ
Tightening the V-belt / Checking V-belt tension ............14
Fuels / Refuelling .....................................................14-15
Starting the engine ........................................................16
Cold-starting .................................................................16
Warm-starting ...............................................................17
Stop engine ...................................................................17
The following industrial property rights apply:
US 08510690, SE 95027298, SE 95027306, IT 95000653,
IT 95000654, GBM 9412558, GBM 9412559.
We want you to be satisfied with your MAKITA product.
In order to guarantee the optimal function and performance of
your Power Cut and to ensure your personal safety we would
request you to perform the following:
Adjusting the carburetor ..................................................18
MAINTENANCE
Read this Instruction and Safety Manual carefully before
putting the Power Cut into operation for the first time,
andstrictlyobservethesafetyregulations!Failuretoobser-
ve these precautions can lead to severe injury or death!
Changing the V-belt ......................................................19
Cleaning the protection hood ........................................ꢀ0
Cleaning / changing the air filter ..............................ꢀ0-ꢀ1
Replacing the spark plug ..............................................ꢀꢀ
Replacing the suction head ..........................................ꢀꢀ
Replacing the starter cable ...........................................ꢀꢁ
Replacing the return spring ...........................................ꢀ4
Cutting attachment in central / side position ............ꢀ5-ꢀ6
Repositioning the cutting attachment .......................ꢀ5-ꢀ6
Replacing/cleaning the spark arrester screen ..............ꢀ6
SPECIAL ACCESSORIES
Diamond cutting discs, trolley, water tank
WARNING!
Some dust created by power sanding sawing, grin-
ding, drilling, and other construction activities contains
chemicals known (to the State of California) to cause
cancer, birth defects or other reproductive harm.
and pressure water system .................................................ꢀ7
Instructions for periodic maintenance ...........................ꢀ8
Service, spare parts and guarantee ................................ꢀ9
Troubleshooting ...............................................................ꢁ0
Extract from spare parts list ............................................ꢁ1
Accessories ..................................................................ꢁ1
Service stations (see enclosure)
Some examples of these chemicals are:
•
•
lead from lead-based paints,
crystalline silica from bricks and cement and
other masonry products, and
•
arsenic and chromium from chemically-
treated lumber.
Your risk from these exposures varies, depending on
how often you do this type of work.
Packing
To reduce your exposure to these chemicals: work in
a well ventilated area, and work with approved safety
equipment, such as those dust masks that are specially
designed to filter out microscopic particles.
Your MAKITA Power Cut is packed in a cardboard box to pre-
vent shipping damage.
Cardboardisabasicrawmaterialandisconsequentlyreuseable
or suitable for recycling (waste paper recycling).
The Emissions Compliance Period referred to on the emission
Compliance label indicates the number of operating hours for
which the engine has been shown to meet federal emissions
requirements.
Category C= 50 hours, B= 1ꢀ5 hours, and A= ꢁ00 hours.
ꢁ
Download from Www.Somanuals.com. All Manuals Search And Download.
Delivery inventory
6
5
4
3
2
1
1. Power Cut
2. Cutting disc
3. Adapter ring 20/25.4
4. Screwdriver (for carburetor adjustment)
5. Offset screwdriver
6. Universal wrench 13/19
In case one of the parts listed should not be included in the
delivery inventory, please consult your sales agent.
7. Instruction manual (not shown)
Symbols
You will notice the following symbols on the saw and in the Instruction Manual:
Read instruction manual and
follow the warning- and safety
precautions!
Never use carbide tipped, circular saw
blades or any kind of wood cutting
blades!
Particular care and caution!
Forbidden!
Combination Start/Stop (I/O) switch,
choke
Wear helmet and eye, respiratory
and hearing protection!
Starting procedure
(Press decompression valve,
Engine - manual start)
Wear protective gloves!
Wear respiratory protection!
Stop engine!
Hazardous dust and/or
gas emission!
Warning!
Kickback!
Fire hazard from flying sparks!
Fuel and oil mixture
First aid
No smoking!
No open fire!
Direction of cutting wheel rotation
Recycling
Warning: the max. peripheral
speed of the cutting disc is 80 m/s!
Do not touch hot surfaces!
Cutting disc dimensions
4
Download from Www.Somanuals.com. All Manuals Search And Download.
SAFETY PRECAUTIONS
Intended use
Power Cut
UsethePowerCutcutoffsawoutdoorsonly,fortrimmingandcutting
suitable materials, using cutting discs rated for this machine.
wear protective goggles (C) or visor when using the Power
Cut.
Improper use:
-
-
-
To prevent hearing damage, always wear suitable personal
hearing protection. (ear muffs (D), ear plugs, etc.). Octave
brand analysis upon request.
Never use the cutoff saw cutting discs for grinding or sanding (using
the side of the cutting disc to remove material). The disc can break!
Never use the Power Cut with saw blades, cutter blades, brushes,
carbide tipped, wood cutting blades etc.
When dry-cutting dust-producing materials such as stone
or concrete, always wear approved respiratory protection
(E).
Unauthorised users:
Work gloves (F) of tough leather are part of the required
work kit of the Power Cut and must always be worn when
working with the Power Cut.
Persons unfamiliar with the Instruction Manual, children, young
people, and persons under the influence of alcohol, drugs or medi-
cations must not use the Power Cut.
General precautions
-
The operator MUST read this instruction manual to ensure
safe operation (even if you already have experience in us-
ing cutoff saws). It is important to be familiar with the opera-
tion of this particular cutoff saw. Users insufficiently informed
will endanger themselves as well as others due to improper
handling.
-
Letonlypersonswhohaveexperienceinusingcutoffsawswork
with this unit. When letting another person use the Power Cut,
this instruction manual must be provided along with it.
1
-
-
First-time operators should ask a specialist to instruct them in
working with gasoline-powered cutoff saws.
Childrenandpersonsunder18yearsofagemustnotbeallowed
to use this Power Cut. Persons over the age of 16 years may,
however, use the Power Cut for the purpose of being trained as
long as they are under the supervision of a qualified trainer.
-
-
Working with the Power Cut requires high concentration.
OperatethePowerCutonlyifyouareingoodphysicalcondition.
If you are tired, your attention will be reduced. Be especially
careful at the end of a working day. Perform all work calmly and
carefully. The user has to accept liability for others.
-
-
-
Never work while under the influence of alcohol, drugs, medica-
tion or other substances which may impair vision, dexterity or
judgement.
ꢀ
A fire extinguisher must be available in the immediate vicinity
when working in easily inflammable vegetation or when it has
not rained for a long time (danger of fire).
Asbestosandothermaterialsthatcanreleasetoxinsmaybecut
only with the necessary safety precautions and after notification
of the proper authorities and under their supervision or that of
a person appointed by them.
-
The use of dust-reduction devices is urgently recommended
(see Accessories, pressure water tank, water tank).
Protective equipment
-
In order to avoid head, eye, hand or foot injuries as well as
to protect your hearing the following protective equipment
must be used during operation of the Power Cut:
ꢁ
-
Thekindofclothingshouldbeappropriate, i. e. itshouldbetight-
fittingbutnotbeahindrance.Clothinginwhichgrainsofmaterial
can accumulate (trousers with cuffs, jackets and trousers with
wide-open pockets, etc.) must not be worn, particularly when
cutting metal.
-
-
Do not wear any jewellery or clothing that can get caught or
distract from the operation of the Power Cut.
It is necessary to wear a protective helmet whenever working
with the Power Cut. The protective helmet (A) is to be checked
in regular intervals for damage and is to be replaced after 5
years at the latest. Use only approved protective helmets.
-
The helmet visor (B) protects the face from dust and material
grains. In order to prevent injuries to eyes and face, always
E
F
4
5
Download from Www.Somanuals.com. All Manuals Search And Download.
-
-
Alwayswearsafetyshoesorboots(G)withsteeltoes,non-skid
soles, and leg protectors when working with the Power Cut.
Safety shoes equipped with a protective layer provide protection
against cuts and ensure a secure footing.
Always wear a work suit (H) of tough material with sufficient
flame-retardant qualities whenever working with the cutoff
saw.
H
G
Fuels / Refuelling
-
Go to a safe, level place before refuelling. Never refuel while
on scaffolding, on heaps of material, or in similar places!
-
-
-
-
Switch off the engine before refuelling the Power Cut.
Do not smoke or work near open fires (6).
5
Let the engine cool down before refuelling.
Fuels can contain substances similar to solvents. Eyes and skin
shouldnotcomeincontactwithmineraloilproducts.Alwayswear
protective gloves when refuelling (not the regular work gloves!).
Frequently clean and change protective clothes. Do not breathe
in fuel vapors. Inhalation of fuel vapours can be hazardous to
your health.
-
Do not spill fuel. If a spill occurs, clean off the Power Cut im-
mediately. Fuel should not come in contact with clothes. If your
clothes have come in contact with fuel, change them at once.
-
-
Ensurethatnofueloozesintothesoil(environmentalprotection).
Use an appropriate base.
6
Refuelling is not allowed in closed rooms. Fuel vapors will ac-
cumulate near the floor (explosion hazard).
-
Ensure to firmly tighten the screw cap of the fuel tank.
-
Before starting the engine, move to a location at least ꢁ meters
(approx. 10 feet) from where you fuelled the Power Cut (7), but
not within the extended swing range of the cutting disc (direction
of sparks).
3 meters
(10 feet)
-
-
-
-
Fuel cannot be stored for an unlimited period of time. Buy only
as much as will be consumed in the near future.
When making up the gasoline/oil mixture, always put the oil in
the mixing container first, and then the gasoline.
Use only approved and marked containers for the transport and
storage of fuel.
7
Keep fuel away from children!
Putting into operation
-
-
-
Do not work on your own. There must be someone around
in case of an emergency (within shouting distance).
Observe all anti-noise regulations when working in residential
areas.
30 m (100 feet)
Never use the Power Cut near inflammable materials or
explosive gases! The Power Cut can create sparks leading
to fire or explosion!
-
-
Make sure that all persons within ꢁ0 meters (100 feet), such
as other workers, are wearing protective gear (see "Protective
Equipment") (8). Children and other unauthorized persons must
remain more than ꢁ0 meters away from the working area. Keep
an eye out for animals as well (9).
= wearing Protective Equipment
8
Before starting work the Power Cut must be checked for
perfect function and operating safety according to the pre-
scriptions. In particular, make sure that the cutting wheel is in
good condition(replace immediately if torn, damaged or bent),
the cutting wheel is properly mounted, the protective hood is
locked in place, the hand guard is properly mounted, the V-belt
has the proper tension, the throttle moves easily and the half-
throttle lock button functions properly, the grips are clean and
dry, and the combination switch functions properly (Start/Stop
(I/O) switch, choke). Visually inspect the muffler for damage and
possible dirt in the muffler area.
-
Start the Power Cut only after complete assembly and inspec-
tion. Never use the Power Cut when it is not completely as-
sembled.
9
6
Download from Www.Somanuals.com. All Manuals Search And Download.
Cutoff discs
-
The protection hood must always be on! Change discs only
with the engine off!
-
There are two basic types of cutoff discs:
- For metal (hot cutting)
- For masonry (cold cutting)
WARNING!
Neverusecarbidetipped,circularsawbladesoranykindofwood
cutting blades. Never cut any type of wood. Reactive forces can
cause severe personal injury from blade contact or thrown tips.
NOTE:Whenusingdiamondcutoffdiscs,alwaysmakesuretoobserve
the "direction of rotation" markings. Diamond discs should only be
used for cutting masonry/brick/ concrete etc.
10
11
1ꢀ
-
Cutoff discs are intended only for radial loading, i.e. for cutting. Do
not grind with the sides of the cutting disc! This will break the disc
(10)!
Caution!
Never change direction (turning radius less than 5 meters (16
feet), exert lateral (sideways) pressure, or tip the Power Cut dur-
ing cutting (11)!
-
Useacuttingdisconlyforcuttingthematerialsitisintendedfor.The
proper type of disc must be used, for either metals or masonry.
The arbor hole of the cutting disc must be an exact fit with the arbor
or shaft. If the arbor hole is larger, it must be fitted with an adapter
ring (available as an accessory).
-
min. 5 m
(16 feet)
-
The cutting disc must be rated for freehand cutting at up to ꢁ850
rpm or 80 m/sec for 400 mm discs, 4ꢁ70 rpm or 80 m/sec for ꢁ50
mm discs, or up to 5100 rpm or 80 m/s for ꢁ00 mm discs. Use only
cutting discs that comply with EN 1ꢀ41ꢁ, EN 1ꢁꢀꢁ6.
The disc must be free of defects (1ꢀ). Do not use defective cutting
discs.
-
Always tighten the cutting disc mounting bolt to a torque of 30
Nm. Otherwise, the cutting disc can twist.
-
Before starting the cutting disc, make sure you have a steady foot-
ing.
-
Put the Power Cut into operation only as described in this instruc-
tion manual (1ꢁ).Always place your left foot in the rear handle and
grasptheotherhandlefirmly(withthumbandfingers).Otherstarting
methods are not allowed.
-
-
WhenstartingthePowerCutitmustbewellsupportedandsecurely
held. The cutting disc must not be touching anything.
If the cutting disc is new, test it by running it at least 60 seconds at
topspeed.Whendoingthis,makesurethatnopersonsorbodyparts
are in the extended swing range of the disc, in case it is defective
and flies apart.
-
When working with the Power Cut always hold it with both
hands. Take the back handle with the right hand and the tubular
handle with the left hand. Hold the handles tightly with your thumbs
facing your fingers.
-
CAUTION: When you release the throttle lever the disc will
keep spinning for a short period of time (free-wheeling effect).
Continuously ensure that you have a safe footing.
-
-
Hold the Power Cut such that you will not breathe in the
exhaustgas.Donotworkinclosedroomsorindeepholes
or ditches (danger of poisoning by fumes).
-
WARNING – CARBON MONOXIDE PRODUCED DURING USE
CANKILL–DONOTUSEPOWERCUTTERINDOORS–MAKE
SURETHEREISPROPERVENTILATIONWHENUSINGPOWER
CUTTER IN TRENCHES OR OTHER CONFINED SPACES.
Switch off the Power Cut immediately if you observe any
changes in its operating behavior.
Switch off the engine before inspecting the V-belt tension or
tighteningit,replacingthecuttingwheel,repositioningthecutter
attachment (side or middle position) or eliminating faults (14).
Turn off the engine immediately and check the disc if you hear or
feel any change in cutting behaviour.
1ꢁ
-
-
● Maintenance
● Refuelling
-
-
● Changing cutoff discs
Turn off the Power Cut when taking a break or stopping work (14).
Place the unit in such a way that the disc is not touching anything
and cannot endanger anyone.
● Repositioning the
cutting attachment
● Stopping work
● Transport
-
Do not put the overheated Power Cut in dry grass or on any inflam-
mable objects. The muffler is very hot (danger of fire).
IMPORTANT:Afterwetcutting,firstturnoffthewaterfeedandthen
let the disc run at least 30 seconds, to fling off the remaining water
and prevent corrosion.
STOP
-
● Putting out of function
14
7
Download from Www.Somanuals.com. All Manuals Search And Download.
Kickback and lock-in
-
-
-
When working with the Power Cut there is a danger of kickback
and lock-in.
Kickback occurs when the top of the cutting disc is used for
cutting (15).
This causes the Power Cut to be thrown back toward the user
with great force and out of control. Risk of injury!
To prevent kickback, observe the following:
-
Never cut with the section of the cutting disc shown in figure 15.
Be especially careful when reinserting the disc into cuts
that have already been started!
15
-
-
Lock-inoccurswhenthecutnarrows(crack,orworkpieceunder
stress).
This causes the Power Cut to suddenly jump forward, out of
control and with great force. Risk of injury!
To prevent lock-in, observe the following:
-
-
When reinserting the disc into previous cuts, have the Power
Cut running at top speed. Always cut at top speed.
Always support the workpiece so that the cut is under tension
(16), so that the cut does not press together and jam the cutting
disc as it proceeds through the material.
-
-
When starting a cut, apply the disc to the workpiece with care.
Do not just shove it into the material.
Never cut more than one piece at a time! When cutting, make
sure that no other workpiece comes into contact.
Working behavior / Method of working
-
Before starting work, check the work area for any hazards
(electrical wires, inflammable substances). Clearly mark the
work area (for example with warning signs or by cordoning off
the area).
16
-
-
-
When working with the Power Cut hold it firmly by the front and
rear handles. Never leave the Power Cut unattended!
Use the Power Cut at high speed as far as possible (see “Tech-
nical Data”).
Only use the Power Cut during good light and visibility periods.
Be aware of slippery or wet areas, and of ice and snow (risk of
slipping).
-
Never work on unstable surfaces. Make sure that there are no
obstacles in the working area, risk of stumbling.Always ensure
that you have a safe footing.
-
-
-
-
Never cut above your shoulder height (17).
Never stand on a ladder to cut (17).
Never use the Power Cut while standing on scaffolding.
Do not lean over too far when working. When putting down and
picking up the Power Cut, do not bend over from the waist, but
instead bend in the knees. Save your back!
17
-
-
-
Guide the Power Cut in such a way that no part of your body
is within the extended swing range of the disc (18).
Use cutting discs only for the materials for which they are de-
signed!
Use cutting discs only for the materials for which they are de-
signed. Do not use the Power Cut to lift up and shovel away
pieces of material and other objects.
Important! Before cutting, remove all foreign objects, such as
rocks, gravel, nails etc. from the cutting area. Otherwise, such
objects can be flung away by the disc with great speed. Injury
hazard!
-
When cutting workpieces down to length use a firm support.
If necessary, secure the workpiece from slipping, but do not
steady it with your foot or allow another person to hold it.
-
-
When cutting round items, always secure them against rota-
tion.
When guiding the Power Cut by hand, use the side mounting
position of the cutter attachment only when actually necessary.
Otherwise, always use the central position. This gives the unit
a better balance, for reduced operator fatigue.
18
8
Download from Www.Somanuals.com. All Manuals Search And Download.
When using synthetic resin cutting discs, always ob-
serve the following:
Cutting masonry and concrete
IMPORTANT!
Always wear approved respiratory protection!
CAUTION:
Asbestos and other materials that can release toxic sub-
stancesmaybecutonlyafternotifyingtheproperauthorities
and under their supervision or that of a person appointed
bythem.Whencuttingprestressedandreinforcedconcrete
piles, follow the instructions and standards of the respon-
sible authorities or the builder of the structural member.
Reinforcementrodsmustbecutintheprescribedsequence
and in accordance with applicable safety regulations.
-
Synthetic resin cutting discs can absorb moisture. This
moisture can cause the disc to become unbalanced at high
speed. This imbalance can cause the disc to break.
-
Do not cool resin cutting discs with water or other fluids.
-
Do not expose resin cutting discs to high humidity or
rain!
Do not use resin cutting discs past their use-by date (expira-
tion date)! The date (quarter and year) is stamped on the disc’s
arbor ring.
NOTE:
Mortar,stone,andconcretedeveloplargequantitiesofdustduring
cutting. To increase the lifetime of the cutting disc (by cooling),
to improve visibility, and to avoid excessive dust creation, we
strongly recommend wet cutting instead of dry cutting.
EXAMPLE: 04 / 2007
This cutting disc can be used through the end of the fourth quarter
of ꢀ007, if properly stored and correctly used.
Cutting metals
IMPORTANT!
Always wear approved respiratory protection!
Materials that can release toxic substances may be cut only
after notifying the proper authorities and under their supervi-
sion or that of a person appointed by them.
CAUTION!
The rapid rotation of the cutting disc heats metal and melts it
at the point of contact. Swing the guard as far down as pos-
sible (19) in order to direct the stream of sparks forward, away
from the operator (fire hazard).
-
Determine the cut line, mark the cut and apply the disc to the
material at moderate speed, to cut a guide groove before going
to top speed and applying more pressure to the Power Cut.
-
-
Keep the disc straight and vertical. Do not tip it, as this can
break it.
The best way to get a good, clean cut is to pull or move the
Power Cut back and forth. Do not simply press the disc into
the material.
19
-
-
Thick round stock is best cut in stages (ꢀ0).
Thin tubing and pipes can be cut with a simple downward
cut.
-
Cut large-diameter pipes as for round stock. To prevent tipping
and for better control, do not let the disc sink too deeply into
the material. Instead, always cut shallow around the whole
piece.
-
Worn discs have a smaller diameter than new discs, so that at
the same engine speed they have a lower effective circumfer-
ential speed and therefore do not cut as well.
-
-
Cut I-beams and L-bars in steps; see Figure ꢀ1.
Cut bands and plates like pipes: along the wide side with a long
cut.
ꢀ0
-
Whencuttingmaterialunderstress(supportedmaterialormate-
rial in structures), always make a notch in the thrust (pressure)
side, and then cut from the tension side, so that the disc does
not lock in. Secure cutoff material from falling!
CAUTION!
If there is a chance that the material is under stress, be pre-
pared for it to kick back. Make sure you can get out of the
way if you have to!
Be particularly careful in scrap-metal yards, junkyards, at ac-
cidentsites,andwithhaphazardpilesofmaterial.Precariously
balancedpiecesorpiecesunderstresscanactinunpredictable
ways, andmayslide, jumpout, orburst. Securecutoffmaterial
from falling! Always exercise extreme caution and use only
equipment that is in perfect working order.
Observetheaccident-preventionrulesandregulationsofyour
employer and/or insurance organization.
ꢀ1
9
Download from Www.Somanuals.com. All Manuals Search And Download.
In wet cutting, the disc is wetted at an equal rate on both sides by
a trickle of water. MAKITA offers the right accessories for all wet
cutting applications (see also "SPECIAL ACCESSORIES").
-
Remove foreign objects such as sand, stones and nails found
withintheworkingarea.Caution:Watchoutforelectricwires
and cables!
The rapid rotation of the cutting disc at the point of contact
throws fragments out of the cut groove at high speed. For
your safety, swing the protection hood down as far as pos-
sible (ꢀꢁ), so that material fragments are thrown forward,
away from the operator.
ꢀꢁ
-
Mark the cut, and then make a groove about 5 mm (just under
1/5") along the entire length of the planned cut. This groove will
then guide the Power Cut accurately guring the actual cutoff.
NOTE:
For long, straight cuts we recommend using a trolley (ꢀ4, see
also "SPECIAL ACCESSORIES"). This makes it much easier to
guide the unit straight.
-
-
Perform the cut with a steady back-and-forth motion.
When cutting slabs to size, you need not cut through the entire
materialthickness(creatingunnecessarydust).Instead,simply
make a shallow groove, and then knock off the excess material
cleanly on a flat surface (25).
CAREFUL!
Whencuttingintolengths,cuttingthroughmaterial,makingcutouts,
etc., always make sure to plan the direction and sequence of cuts
in such a way that the disc does not get jammed by the cut-off
piece, and that no persons can be injured by falling pieces.
Transport and storage
-
-
-
Always turn off the Power Cut when transporting it or
moving it from place to place on a site (ꢀ6).
ꢀ4
Never carry or move the unit with the engine on or the
disc moving!
Carry the unit only by the tubular (middle) handle with the cut-
ting disc pointing behind you (ꢀ6). Avoid touching the exhaust
muffler (burn hazard!)
-
-
When moving the Power Cut over longer distances, use a
wheelbarrow or wagon.
When transporting the Power Cut in a vehicle, make sure it is
securely positioned in such a way that no fuel can leak out.
Always remove the cutting disc before transporting the unit in
a vehicle. Before transporting in a vehicle, allow the Power Cut
to cool off completely. Note: Mufflers with catalytic converters
take longer to cool off!
-
-
The Power Cut should be stored safely in a dry place. It must
not be left outdoors! Always dismount the cutting disc before
storage. Keep the Power Cut away from children.
ꢀ5
Before long-term storage and before shipping the Power
Cut, follow the instructions in the chapter on "Periodic
care and maintenance". ALWAYS empty the fuel tank and
run the carburetor dry.
-
When putting cutting discs in storage, be careful to:
•
Cleananddrythemwell.CAUTION:DoNOTcleansynthetic
resin cutting discs with water or other fluids!
Store them lying down flat.
•
•
Avoid dampness, freezing temperatures, direct sunshine,
high temperatures and temperature fluctuations, as these
can cause breakage and splintering.
•
Before re-using a resin cutting disc, make sure of the use-by
(expiration) date (quarter and year, stamped on the arbor
ring). If this date has been exceeded, do NOT use the cutting
disc.
-
Always check new cutting discs or cutting discs that have
been in storage to make sure that they are free of defects
and before the first cut test-run the tool at top speed for at
least 60 seconds. Keep body parts and people well away out
of range of the direction of the cutting disc during this test.
ꢀ6
10
Download from Www.Somanuals.com. All Manuals Search And Download.
Maintenance
-
-
-
-
Beforeperformingmaintenanceworkswitchoffthe Power
Cut (ꢀ7) and pull out the plug cap.
Allow the Power Cut to cool off before doing any mainte-
nance work (burn hazard)!
Power Cuts with catalytic converter take longer to cool
down!
Always check the Power Cut before using it to make sure that
it is in good working order. In particular, make sure that the
cutting disc is properly mounted. Make sure that the cutting
wheel is undamaged and suitable for the job it will be used
for.
ꢀ7
ꢀ8
ꢀ9
-
Operate the Power Cut only at a low noise and emission level.
For this ensure the carburetor is adjusted correctly.
-
Do not operate the Power Cut with a defective or modified
muffler.
-
-
Clean the Power Cut regularly.
Check the fuel tank cap regularly for good sealing.
Observe the accident prevention instructions issued by
trade associations and insurance companies. NEVER
make any modifications to the Power Cut! You will only
be putting your own safety at risk!
Perform only the maintenance and repair works described in
the instruction manual. All other work must be carried out by
MAKITA Service.
SERVICE
Use only original MAKITA spares and accessories.
The use of non-MAKITA spares, accessories, or cutting discs
increases the risk of accident. We cannot accept any respon-
sibility for accidents or damage occurring in association with
the use of cutting discs or accessories other than original
MAKITA.
First aid
For the event of a possible accident, please make sure that a
firstaidkitisalwaysimmediatelyavailablecloseby.Immediately
replace any items used from the first aid box.
When calling for help, give the following information:
- Place of the accident
- What happened
- Number of injured people
- Kind of injuries
- Your name!
NOTE
Individuals with poor circulation who are exposed to excessive
vibration may experience injury to blood vessels or the nervous
system.
Vibration may cause the following symptoms to occur in the fin-
gers, hands or wrists: ”Falling asleep” (numbness), tingling, pain,
stabbing sensation, alteration of skin colour or of the skin. If any
of these symptoms occur, see a physician!
Disposal and environmental protection
Be mindful of the environment!
Dispose of worn-out or defective cutting discs in accordance with
your local disposal regulations. To protect unusable cutting discs
from misuse, destroy them before disposal.
When the Power Cut is worn out or damaged beyond repair, have
it disposed of or recycled in an environmentally sound manner. If
necessary, consult your local authorities.
11
Download from Www.Somanuals.com. All Manuals Search And Download.
Technical data
DPC7331HD, DPC7341HD
Displacement
Bore
cu in (cmꢁ)
in (mm)
in (mm)
hp (kW)
Nm
4,5 (7ꢁ)
1,97 (50)
1,46 (ꢁ7)
5,6 (4,ꢀ)
5,0
Stroke
Max. power
Max. torque
Idling speed
rpm
rpm
ꢀ.500
ꢁ.800
Clutch engagement speed
Engine speed limitation
rpm
rpm
9.ꢁ50
4.ꢁ00
Max. spindle speed
Sound pressure level at the operators ear 1)
Sound pressure level at the bystander’s position (50 ft)1)
Vibration acceleration ah,w per EN 1454
- Tubular handle (idle/rated spindle speed)
- Rear handle (idle/rated spindle speed)
Carburetor (diaphragm carburetor)
Ignition system (with speed limitation)
Spark plug
dB (A)
dB (A)
104
86
m/sꢀ
m/sꢀ
Type
7 / 6
8 / 7
WALBRO WJ-1ꢀꢁ
electronic
Type
Type
NGK BPMR 7A / BOSCH WSR 6F / CHAMPION RCJ 6Y
Electrode gap
in (mm)
kg/h
.0ꢀ0 (0,5)
ꢀ,1
500
Fuel consumption at max. load per ISO 889ꢁ
Specific consumption at max. load per ISO 8893
Fuel tank capacity
g/kWh
fl oz (l)
37 (1,1)
Mixture ratio (fuel/two-stroke oil)
- when using MAKITA Synthetic oil
- when using other synthetic oil (quality grade JASO FC or ISO EGD)
50:1
50:1
14" / 1" / 0.ꢀ" ꢁ)
Cutting disc for 80 m/sec. ꢀ)
in
ꢁ)
Arbor diameter
V-belt
Overall weight (tanks empty, without cutting disc )
in
1"
part no.
lb
965 ꢁ00 470
ꢀꢀ.04
1) According to UL-test requirement under full load (cutting concrete).
ꢀ) Circumference speed at max. engine speed
ꢁ) Outside diameter / arbor hole / thickness
3
4
5
6
7
Denomination of components
Identification plate (1ꢀ)
DPC7331
Indicate when ordering spare parts
2008 123456
2
26
Serial number
22045 Hamburg, Germany
Year of manufacture
394.XXX.XXX Typ 394
1
8
1
2
3
4
5
6
7
8
9
Handle
Filter cover for air filter and spark plug cap
Cover lock
Tubular handle
Muffler
Protection hood
Grip
V-belt tension adjusting screw
Retaining nuts
9
14
13 12
11
10
15
16
10 Stand
11 Carburetor adjustment opening
12 Identification plate
13 Fuel tank with handle
14 Decompression valve
15 Starter grip
25
24
23
17
16 Air intake
17 Combination Start/Stop (I/O) switch, choke
18 Stop knob for halfway throttle
19 Safety locking button
20 Throttle lever
18
19
21 Tank cap (fuel)
22 Starter housing with starter
23 Cutting disc
24 Disc bolt
20
25 Spring washer
26 Hold opening
22
21
1ꢀ
Download from Www.Somanuals.com. All Manuals Search And Download.
PUTTING INTO OPERATION
CAUTION:
Always turn off the engine and pull off the spark plug cap
before doing any work on the Power Cut! Always wear
protective gloves!
CAUTION:
Start the Power Cut only after complete assembly and
inspection.
For the the following work, use the assembly tools included
with delivery:
1. 1ꢁ/19 AF combination wrench
ꢀ. Allen key
ꢁ. Carburetor adjustment screwdriver
4. Adapter ring
Place the Power Cut on a stable surface and carry out the fol-
lowing assembly steps:
1
2
3
4
Schematic drawing
Mounting the cutting disc
Inspect the disc for damage.
See SAFETY INSTRUCTIONS, Page 6.
Unscrew screw (9) and remove the spring washer (8).
Place the cutting disc (5) on the arbour (7).
Note: The arbor hole of the cutting disc must be an exact fit
with the arbor or shaft. If the arbor hole is larger, it must be fitted
with an adapter ring (*).
Make sure the cutting disc is installed so it turns in the right
direction, if a direction is marked on the disc.
Place the spring washer (8) on the arbour and insert the screw
(9) and tighten by hand.
Turn the disc slowly until the stop hole of the V-belt pulley is
visible in the cutting arm cover (10).
8
1
10
2
Insert the Allen key (2) as far as it will go. The shaft is now
blocked.
Tighten the screw with the combination wrench (1)
NOTE: Tighten the screw firmly (30 ± 2 Nm), as otherwise
the cutting wheel may slip during cutting.
1ꢁ
Download from Www.Somanuals.com. All Manuals Search And Download.
Tightening the V-belt / Checking V-belt tension
IMPORTANT:
Exact V-belt tension is essential for maximum cutting per-
formancewithminimumfuelconsumption. ImproperV-belt
tensionwillresultinprematureweartotheV-beltandV-belt
wheel or damage to the clutch bearing.
If the Power Cut is new or the V-belt has been replaced,
retighten the V-belt after the first hour of operation!
NOTE: The two fastening nuts (11) must be loosened before
tightening the V-belt or checking the tension.
To increase the belt tension, turn the tightening screw (12) to
the right (clockwise) with the combination wrench included with
the Power Cut.
Thebelttensioniscorrectlyadjustedwhenthenut(13)iscenterd
on the mark (14).
IMPORTANT:
After tightening/inspection, make certain to tighten
the fastening nuts (11) (30 ± 2 Nm).
Fuels
Caution:
This tool uses mineral-oil products (gasoline and oil).
Be especially careful when handling gasoline.
Do not smoke. Do not allow gasoline to come near flames,
sparks or fire (explosion hazard).
50:1
Gasoline
Fuel mixture
OIL
Thistoolispoweredbyahigh-performanceair-cooledtwo-stroke
engine. It runs on a mixture of gasoline and two-stroke engine
oil.
+
50:1
The engine is designed for unleaded regular gasoline with a
min. octane value of 87 (R+M)/ꢀ. In case no such fuel is avail-
able, you can use fuel with a higher octane value. This will not
affect the engine.
1.0 Us-gal. (3.7 l)
ꢀ.5 Us-gal. (9.4 l)
5.0 Us-gal. (18.9 l)
2.6 floz. (75 cmꢁ)
6.4 floz. (189 cmꢁ)
12.8 floz. (378 cmꢁ)
In order to obtain an optimum engine output and to protect
your health and the environment use unleaded fuel only.
The correct mixture ratio:
50:1 WhenusingMAKITAsynthetictwo-strokeengine
oil, i. e. 50 parts gasoline to 1 part oil.
To lubricate the engine, use a synthetic oil for two-stroke air-
cooled engines (quality grade JASO FC or ISO EGD), which
has to be added to the fuel.
50:1 When using other synthetic two-stroke engine
oil(qualitygrade JASOFCorISOEGD),i.e.50
parts gasoline to 1 part oil.
14
Download from Www.Somanuals.com. All Manuals Search And Download.
MAKITA synthetic two-stroke engine oil (50:1) is available in
the following sizes to suit your individual requirements:
The Storage of Fuel
Fuels have a limited storage life. Fuel and fuel mixtures
age through evaporation, especially at high temperatures.
Aged fuel and fuel mixtures can cause starting problems
and damage the engine.Purchase only that amount of fuel,
which will be consumed over the next few months. At high
temperatures, once fuel has been mixed it should be used
up in 6-8 weeks.
2.6 floz. order number T-00745
6.4 floz. order number T-00739
NOTE: For preparing the fuel-oil mixture first mix the entire oil
quantity with half of the fuel required, then add the remaining
fuel. Shake the finished mixture thoroughly before pouring it
into the tank.
Use only approved and marked containers for transport
and storage. Store fuel only in dry, cool and secure
locations!
Caution: Open the tank cap carefully, as pressure might
have built up inside!
It is not wise to add more engine oil than specified to
ensure safe operation. This will only result in a higher
productionofcombustionresidueswhichwillpollutethe
environmentandclogtheexhaustchannelinthecylinder
as well as the muffler. In addition, fuel consumption will
rise and performance will decrease.
AVOID SKIN AND EYE CONTACT
Mineral oil products degrease your skin. If your skin comes in
contactwiththesesubstancesrepeatedlyandforanextended
periodoftime,itwilldryout.Variousskindeseasesmayresult.
In addition, allergic reactions are known to occur.
Eyes can be irritated by contact with oil. If oil comes into your
eyes, immediately wash them with clear water.
If your eyes are still irritated, see a doctor immediately!
Refuelling
IMPORTANT:
FOLLOW THE SAFETY PRECAUTIONS!
Be careful and cautious when handling fuels.
The engine must be turned off and cooled down!
Carefully clean the area around the fuel-tank filler neck to keep
dirt from getting in the tank.
Place the unit on its side on an even surface.
Unscrew the tank cap and fill tank with fuel mixture. Take care
to avoid spilling.
Screw the tank cap back on hand-tight.
Cleanscrewcapandtankafterrefuelling. Neverstartorop-
erate the Power Cut in the same place as it was fuelled!
Fuel mixture
If fuel gets on your clothing, change clothes immediately.
15
Download from Www.Somanuals.com. All Manuals Search And Download.
Starting the engine
if
necessary
This model is fitted with a semiautomatic decompression valve
(1) to make starting easier. Depressing it reduces the force
needed for compression, so little force is needed to accelerate
the engine to its starting speed.
The high pressure in the combustion chamber after the first
ignition automatically closes the decompression valve (button
pops out).
CAUTION:
Observe the SAFETY INSTRUCTIONS on page 5 and 6!
Start the Power Cut only after complete assembly and
inspection!
Move at least 3 m away from the place where you fuelled
the Power Cut.
3 meters (10 feet)
Make sure you have a good footing, and place the Power
Cut on the ground in such a way that the cutting disc is
not touching anything.
Move the protective hood (3) into the proper position for the
work you intend to do (see illustration).
Grasp the grip (2). The hood (3) can swing in both ways within
its range of motion.
Caution:
Alwaysmakesurethatthestraightouteredgeoftheimpactplate
(4) and the edge of the hood are parallel (see arrows).
If this is not the case, take the tool to a service center.
Cold-starting
Move the combination switch (6) up (choke position).
Grasp handle (hand pressure actuates the grip throttle lever
lock (8)).
Push the throttle (9) in all the way and hold it.
Press the throttle lock (7) and release the throttle (9) (the throttle
lock will hold the throttle at half-throttle position).
NOTE: If the Power Cut is in a trolley, bring the control lever to
the third or fourth detent.
Depress decompression valve (5).
16
Download from Www.Somanuals.com. All Manuals Search And Download.
Grasp the tubular handle firmly with one hand and press the
Power Cut against the ground.
Place the tip of your left foot in the rear handle.
Pull the starter cable strong and rapidly until you hear the
first audible ignition.
CAUTION: Do not pull out the starter cable more than approx.
50 cm, and lead it back by hand.
Depress decompression valve (5) again.
Put the combination switch (6) in position “I”.
Keep pulling the starter cable until the engine catches.
Assoonastheengineisrunning, pressthethrottle(9)torelease
the half-throttle lock (7), allowing the engine to idle.
Warm-starting
As described under ”Cold starting”, except without putting the
combination switch (F/6) in choke position.
Stopping the engine
Push the combination switch (1) down to position
.
STOP
10
17
Download from Www.Somanuals.com. All Manuals Search And Download.
Adjusting
the carburetor
NOTE: The grinding parts are equipped with an electronic
ignition to limit the speed. The carburetor also has a fixed
jet which cannot be adjusted.
At the factory the idling speed has been set to approx.
2,500 rpm, but the running-in process of a new engine may
require slight readjustment of the idling speed.
For correct adjustment of the idling speed the following
steps must be carried out:
2
Start the engine and run it until it is warm (about ꢁ - 5 minutes).
1
Adjust the carburetor with the screwdriver (1, Order No. 944
ꢁ40 001) included with the Power Cut. It has a lug that helps
with adjustment.
Readjust the idling speed.
If the cut-off disc is still turning when the engine is running,
unscrew the adjusting screw of the throttle valve (2) until the
cut-off disc is no longer turning. When the engine is left running
at idling speed, loosen the screw a little.
Switch off the engine.
18
Download from Www.Somanuals.com. All Manuals Search And Download.
MAINTENANCE
CAUTION:
BeforedoinganyworkonthePowerCutturnofftheengine,
remove the cutting disc, pull the plug cap off the spark plug
and wear protective gloves!
CAUTION:
Start the Power Cut only after complete assembly and
inspection.
IMPORTANT:
Because many of the parts and assemblies not mentioned
in this Instruction Manual are vital to the safety of the unit,
and because all parts are subject to a certain amount of
wear and tear, it is important for your own safety that you
havetheunitcheckedandmaintainedregularlybyaMAKITA
service center.
IMPORTANT:
SERVICE
If the cutting wheel breaks during cutting, the
Power Cut must be repaired by a MAKITA service
center before being used again!
Changing the V-belt
Loosen nuts (3).
Loosen the tightening screw (1) (counter-clockwise) until the
end of the screw (2) is visible in the gap.
Unscrew the nuts (3) and remove the cover (4).
Remove the screws (5) and (7) and remove the side piece (6).
NOTE:
Screw (5) is longer than screws (7). Make sure
to put them back in the right places during reas-
sembly!
Unscrew the screws (8) and remove the crankcase housing
cover (9).
Remove the old belt (10) or belt pieces.
Clean out the inside of the drive arm with a brush.
Put in a new V-belt.
NOTE:
Reassemble the crankcase housing cover (9), side piece (6)
and cover (4) in the reverse order.
To tighten the V-belt see ”Tightening the V-belt / Checking
V-belt tension”.
19
Download from Www.Somanuals.com. All Manuals Search And Download.
Cleaning the protection hood
Over time, the inside of the protective hood can become caked
with material residue (especially from wet cutting), which if
allowed to accumulate can hinder the free rotation of the cut-
ting disc. For this reason the hood must be cleaned out from
time to time.
Take off the cutting wheel with spring washer and remove the
accumulated material from inside the hood with a strip of wood
or similar implement.
NOTE: To install the cutting wheel see ”Mounting the cutting
wheel”.
Clean the shaft and all removed parts.
Cleaning / changing the air filter
Turn the cover lock (11) counterclockwise to release it, and
carefully remove the filter cover (12).
There is a gasket (15) between the filter cover (12) and the
hood (14).
Remove screws (13) and take off the cover (14).
Clean the O-ring (15) with a brush and inspect for damage.
Take the pre-filter (foam, 17) out of the filter cover.
Pull the air filter insert (paper cartridge, 18) out of the cover.
Remove the inner filter (16) from the intake opening.
Note:
Do not allow dirt to get into the carburetor!
Switch the combination switch to ”Choke” or cover the carbure-
tor with a clean cloth.
ꢀ0
Download from Www.Somanuals.com. All Manuals Search And Download.
CAUTION: Turn off the engine before cleaning the air filter! Never clean out the air filter with compressed air! Do
not clean the pre-filter and inner filter with fuel.
The service life of the engine depends on the condition and regular maintenance of the filter elements. Failure to
perform maintenance and cleaning at the prescribed intervals will cause increased wear inside the engine!
If the air filter becomes damaged, replace immediately! Pieces of cloth or large dirt particles can destroy the engine!
Do not work in dusty conditions when it can be avoided! The fine dust generated when dry-cutting concrete and stone
is hazardous to the health of the operator and also shortens the service life of the engine. Whenever possible, wet-cut
with water when working in concrete and stone, to bind the dust.
Pre-filter (dry foam)
Pre-filter (foam with air-filter oil)
If the pre-filter (1, Order No. ꢁ95 17ꢁ 080) is dirty, wash Clean or replace (when cutting with high dust amounts):
it out in lukewarm water with standard dishwashing liquid
or MAKITA filter cleaner (Order No. 980 008 627). If using
MAKITA filter cleaner, proceed as described after the text
section "Cleaning".
•
Daily
or at least every
4 operating hours, or
8 tank fillings, or
8 litres fuel mixture.
•
•
•
Let the pre-filter dry thoroughly.
NOTE: The pre-filter must be cleaned daily, or several times Clean or replace (when cutting wet, or when cutting steel):
daily if working under dusty conditions. If cleaning is not
possible on-site, have spare pre-filters on hand. Replace the
pre-filter at least every 25 operating hours.
•
weekly
or at least every
ꢀ5 operating hours, or
50 tank fillings, or
55 litres fuel mixture.
•
•
•
To improve filtration effectiveness, the pre-filter can be wet-
ted with air-filter oil. Before adding air-filter oil, carefully wash
the filter with air-filter cleaner. Care for the oiled air filter as
described for Pre-filter (foam with air-filter oil).
Cleaning: Cleaning: Rinse off coarse dirt in running water.
Knead a capful MAKITA filter cleaner (Order No. 980 008 627
into the foam material of the pre-filter (1, Order No. ꢁ95 17ꢁ
090) until it suds up well.
To insert the pre-filter in the filter cover, position it so it fits the
space in the cover and then press it in (5). The pre-filter must
fit completely and cover all parts of the filter space, without
leaving any spaces unfiltered.
Rinse out pre-filter thoroughly in running water.
Let the pre-filter dry thoroughly.
In order to ensure full filtration effectiveness, air-filter
oil must be used with the pre-filter. Wet the pre-filter
with a capful (about 20 ccm) of MAKITA air-filter oil
(Order No. 980 008 6ꢀ8, biodegradable).
Knead the pre-filter to evenly distribute the oil. Then
squeeze out any excess oil.
NOTE: If using other air-filter oils, follow the manufacturer’s
instructions.
If cleaning is not possible on-site, have spare pre-filters on
hand (Order No. ꢁ95 17ꢁ 090).
To insert the pre-filter in the filter cover, position it so it fits the
space in the cover and then press it in (5). The pre-filter must fit
completely and cover all parts of the filter space, without leaving
any spaces unfiltered.
Inner filters
Wash out the dirty inner filter (3, Order No. ꢁ95 17ꢁ 0ꢀ0)
in lukewarm soapy water with regular dishwashing liquid or
MAKITA filter cleaner (Order No. 980 008 627).
Let the inner filter dry thoroughly.
Air filter insert (paper cartridge)
The air filter insert (2, Order No. ꢁ95 17ꢁ 010) filters the intake
air through a very fine paper filter lamella system. For the rea-
son the cartridge must never be washed. Clean the air filter
insert once a week.
To clean the air filter insert, spread it out slightly and carefully
tap it against a clean surface.
Replace the air filter insert every 100 operating hours. Replace
it immediately if there is a drop in power, drop in speed, or
smoke in the exhaust.
Before installing the filter system, check the intake opening to
make sure no dirt particles have fallen in. If they have, remove
them.
ꢀ1
Download from Www.Somanuals.com. All Manuals Search And Download.
7
8
Replacing the spark plug
CAUTION:
Do not touch the spark plug or plug cap if the engine is
running (high voltage).
Switch off the engine before starting any maintenance
work.
A hot engine can cause burns. Wear protective gloves!
The spark plug (Order No. 965 60ꢁ 0ꢀ1) must be replaced in
case of damage to the insulator, electrode erosion (burn) or if
the electrodes are very dirty or oily.
Remove the filter cover and hood. See Cleaning / changing
the air filter.
Pull theplug cap (7)offthespark plug. Use only thecombination
wrench supplied with the saw to remove the spark plug.
CAUTION: To prevent damage to the decompression valve
(8), when unscrewing the spark plug position the combina-
tion tool in such a way that it does not impact the valve.
CAUTION: Use only BOSCH WSR
6F spark plug, CHAMPION RCJ-6Y or
NGK BPMR 7A.
0,5 mm
Electrode gap
The electrode gap must be .0ꢀ0" (0.5 mm).
Checking the ignition spark
Insert the combination tool (9) between the ventilation hood and
cylinder only as shown in the illustration.
CAUTION!
Do not insert the combination tool into the spark plug hole,
but make contact only with the cylinder (otherwise you may
damage the engine).
Using insulated pliers, hold the spark plug (10) (unscrewed but
with the plug cap on) against the combination tool (away from
the spark plug hole!).
Switch the combination switch (11) to ”I”.
Pull the starter cable hard.
If the function is correct, an ignition spark must be visible near
the electrodes.
Replacing the suction head
The felt filter (13) of the suction head can become clogged.
It is recommended to replace the suction head once every
three months in order to ensure unimpeded fuel flow to the
carburetor.
Unscrew the tank cap (12), pull the retainer out of the open-
ing.
Empty fuel tank.
Use a wire hook to pull the suction out of the tank opening for
replacement.
Caution: Do not allow fuel to come into contact with skin!
ꢀꢀ
Download from Www.Somanuals.com. All Manuals Search And Download.
14
15
Replacing the starter cable
B
Remove four screws (14). Remove starter housing (15).
18
Unscrew two screws (16) and carefuly remove the air guide
(17) from the starter housing (15). Proceed in the order (A - B
- C - D).
A
16
17
D
Remove all pieces of cable (18).
C
Thread in a new starter cable (dia 4.0 mm, length 1000 mm) as
shown (don’t forget the disc (19)) and knot both ends.
21
Pull knot (20) into the cable pulley (21).
20
CAUTION: Do not let the knots or the cable ends protrude from
the outside of the cable pulley.
Pull knot (22) into the cable grip (23).
23
22
19
Guide the cable into the recess (24) on the cable drum and
use the cable to turn the drum two turns in the direction shown
by the arrow.
Holdingthecabledruminyourlefthand,straightenoutthetwistin
the cable with your right hand, pull the cable tight, and hold.
Release the cable drum. The drum´s spring force will now wind
the cable around the drum.
Repeat three times. The starter grip must be upright on the
starter housing.
NOTE: With the cable pulled all the way out, it must still be
possible to turn the pulley another 1/4 turn against the return
spring.
24
CAUTION!
Injury hazard! When you pull out the starter cable hold the
starter handle firmly. It will whip back if the cable pulley is
released by accident.
26
Install the air guide (17) in reverse order. Make sure that the
nub (25) fits into the slot (26) in the starter housing.
When putting the starter housing back on, it may be necessary
to pull the starter handle slightly until the starting mechanism
engages.
25
ꢀꢁ
Download from Www.Somanuals.com. All Manuals Search And Download.
Replacing the return
spring
Remove the starter housing (see “Replacing the starter
cable”).
Take the air guide off the starter housing (see “Replacing the
starter cable”).
Take off circlip (1) (circlip pliers, see “Accessories”).
Remove the cable pulley (2).
Unscrew screw (3).
5
Evenly lever the return spring (4) out of the catch using a screw-
driver or similar tool. Be extremely careful - the return spring
is under tension and can pop out of its housing!
CAUTION! Injury hazard! Wear eye protection and work
gloves when performing this work!
4
Replacement return springs are delivered already tensioned in
the housing. CAREFUL - the spring can pop out. If it does,
it can be put back in as shown in the diagram (observe the
direction of rotation).
3
2
Before installing the new return spring (4) in the starter hous-
ing, grease it lightly with multipurpose grease, Order No. 944
ꢁ60 000. Then position it and press it until the tabs (5) engage
in the slots.
1
Do not grease the cable drum (2) or bearing journal!
Screw in bolt (3) but do not tighten it hard.
Turn the cable pulley slightly when putting it back on, until you
hear it catch. Put the circlip back on.
Wind on the starter cable (see above under “Replacing the
starter cable”).
Reinstall the air guide (see above under “Replacing the starter
cable”)
When putting the starter housing back on, it may be necessary
to pull the starter handle slightly until the starting mechanism
engages.
ꢀ4
Download from Www.Somanuals.com. All Manuals Search And Download.
Cutting attachment in
central / side position
NOTE: The Power Cut is delivered with the cutting attachment
mounted in the middle position (1). For cutting up against ob-
stacles, such as curbs or walls, the cutting attachment can be
mounted to one side (2). Use this position only when actually
necessary, and afterwards return the cutting attachment to the
middle position
In this position the Power Cut has better balance, is easier to
guide, and is not as fatiguing for the operator.
Repositioning the cutting attachment
Loosen nuts (5).
Loosen the tightening screw (3) (counter-clockwise) until the
end of the screw (4) is visible in the gap.
Unscrew the nuts (5) and remove the cover (6).
Use the combination tool (9) to lever out the stop pin (8) as
shown in the illustration, until the protective hood (11) can be
turned.
NOTE: The turn stop (7) is deactivated when the stop pin (8) is
removed. This permits the hood (11) to be turned farther than
the turn stop (7).
Unscrew the grip (10) and turn the protective hood (11) as
shown in the illustration.
10 11
Disengage the V-belt (12) and remove the cutting attach-
ment.
8
9
12
ꢀ5
Download from Www.Somanuals.com. All Manuals Search And Download.
Press the cutting attachment (13) onto the drive arm in the
side position.
Guide the V-belt (14) over the V-belt pulley (15).
13 15 14
Put the guard plate (16) on.
Screw on nuts (17) and tighten by hand.
18
To tighten the V-belt see ”Tightening the V-belt / Checking V-
belt tension”.
Tighten the nuts (17) firmly with the combination wrench.
Replace the grip (18) as shown.
IMPORTANT:
When you reposition the cutting attachment, the direction
of rotation of the cutting wheel changes.
16
If a rotation direction is marked on the cutting disc, make
sure the disc turns in the right direction.
17
Replacing/cleaning the spark arrester screen
Models without catalytic converter
The spark arrester screen should be checked and cleaned
regularly.
20
Models without catalytic converter (DPC7ꢁꢁ1HD)
Loosen the ꢀ screws (19) and remove the spark arrester
screen (20).
19
Models with catalytic converter
Models with catalytic converter (DPC7ꢁ41HD)
Unscrew and remove screws (21). Remove the front housing
section of the muffler (22).
Unscrew and remove screw (23). Remove the deflector plate
and spark arrester screen (24).
CAUTION:
23 24
21
22
Do not use sharp or pointed objects for screen cleaning.
Damaged or misformed screen wires may result.
Reassembly the spark arrester screen and tighten the screws.
Information on the catalytic converter: The catalytic converter
reduces the pollutant content of the exhaust.
ꢀ6
Download from Www.Somanuals.com. All Manuals Search And Download.
SPECIAL ACCESSORIES
Diamond cutting discs (1)
Water tank (5)
The water tank is designed to be mounted on the guide trol-
ley. Its high capacity makes it especially suitable for situations
involving frequent site changes. For filling or for fast changing
to reserve tanks, the tank can be simply lifted off the trolley.
MAKITA diamond cutting discs meet the highest demands
in working safety, ease of operation, and economical cut-
ting performance. They can be used for cutting all materials
except metal.
The water tank comes with all necessary connections and
hoses. Mounting to the trolley and Power Cut are very fast
and simple.
The high durability of the diamond grains ensures low wear
and thereby a very long service life with almost no change in
disc diameter over the lifetime of the disc. This gives consistent
cutting performance and thus high economy. The outstanding
cutting qualities of the discs make cutting easier.
The metal disc plates give highly concentric running for minimal
vibration during use.
Mains/pressure water system (6)
The mains/pressure water system is designed to be mounted
on the Power Cut. It can be used with or without the trolley,
but is especially suitable for applications involving hand-held,
stationarycutting.Thewaterlinehasafast-releaseconnection,
and can be fed either from a mains supply or from a pressure
tank (7).
The use of diamond cutting discs reduces cutting time sig-
nificantly. This in turn leads to lower operating costs (fuel
consumption, wear on parts, repairs, and last but not least
environmental damage).
The water system comes with all necessary connections
and lines. It can be quickly and easily mounted on the Power
Cut.
Guide trolley (ꢀ)
The MAKITA guide trolley makes it much easier to do straight
cuts,whilesimultaneouslyenablingalmostuntiringworking.Itcan
be adjusted for the operator´s height, and can be operated with
the cutting attachment mounted in the middle or on the side.
See “Accessories” for order number.
For easier refuelling when using the trolley, we recommend
adding an angled tank filler neck (3).
A depth limiter can be added for still easier and more accurate
cutting. Itmakesitpossible tomaintainaprecisepredetermined
cut depth (4).
To keep down dust and for better cutting-disc cooling, MAKITA
offers several options for wetting the disc during operation.
5
2
4
1
7
6
3
ꢀ7
Download from Www.Somanuals.com. All Manuals Search And Download.
Instructions for periodic maintenance
To ensure long life, prevent damage and ensure the full functioning of the safety features the following maintenance must be per-
formed regularly. Guarantee claims can be recognized only if this work is performed regularly and properly. Failure to perform the
prescribed maintenance work can lead to accidents!
Users of the Power Cut must not perform any maintenance work not described in this Instruction Manual. All such work must be
carried out by a MAKITA service centre.
Page
General
Entire Power Cut
Clean exterior, check for damage. In case of damage,
have repaired by a qualified service centre immediately
Cutting disc
Clutch
Inspect regularly for damage and wear.
Have inspected at a service center.
Clean, Check position (impact plate)
7
Protection hood
16
7
Before each start
Cutting disc
Inspect for damage and make sure the cutting wheel is
right for the job
V-belt
Check V-belt tension
Adjust position
19
Protective hood
Combination switch,
Safety locking button,
Throttle lever
Functional check
Functional check
Functional check
16
Tank cap
Check for tightness and lekages
Every day
Air filter
Clean (if necessary more frequently); pre-filter (foam)
maintenance as described above under Cleaning /
changing the air filter
ꢀ0-ꢀ1
18
Idle speed
Check (cutting disc must not turn on idle)
Extreme dust
Clean filter insert (paper cartridge)
20-21
Every week
Starter housing
Starter cable
V-belt
Clean to ensure proper air cooling
Check for damage
1ꢀ
ꢀꢁ
Check V-belt tension, inspect for damage and wear
Clean, replace after 100 operating hours
Check and replace if necessary
14, 19
20-21
ꢀꢀ
Air filter insert
Spark plug
Muffler
Check tightness of mounting, clean or replace
spark arrester screen if necessary
1ꢀ / ꢀ6
Every 3 months
Suction head
Fuel tank
Replace
Clean
ꢀꢀ
1ꢁ
Annually
Storage
Entire Power Cut
Entire Power Cut
Check at an authorized service centre
Clean exterior, check for damage. In case of damage,
have repaired by a qualified service centre immediately
Cutting disc
Fuel tank
Carburetor
Remove and clean
Empty and clean
Run empty
ꢀ8
Download from Www.Somanuals.com. All Manuals Search And Download.
Service, spare parts and guarantee
Maintenance and repair
The maintenance and repair of modern cutoff saws and their safety-related components requires qualified technical training and a
workshop equipped with special tools and testing devices.
We therefore recommend that you consult a MAKITA service center for all work not described in this instruction manual.
The MAKITAservice centers have all the necessary equipment and skilled and experienced personnel, who can work out cost-effective
solutions and advise you in all matters.
Please contact your nearest service center or the general trading company or importer (see last page), who will gladly provide you
with the address of your nearest MAKITA service center.
Spare parts
Reliable long-term operation, as well as the safety of your Power Cut, depend among other things on the quality of the spare parts
used. Use only original MAKITA parts, marked
Only original parts are from the same production line as the original unit and therefore ensure the highest possible quality of materi-
als, dimensions, functioning and safety.
Only original spare parts and accessories guarantee the highest quality in material, dimensions and function.
Original spare parts and accessories can be obtained from your local dealer. He will also have the spare part lists to determine the
required spare part numbers, and will be constantly informed about the latest improvements and spare part innovations. To find your
Please bear in mind that if parts other than original MAKITAspare parts are used, this will automatically invalidate the MAKITAproduct
guarantee. We will furthermore not accept any liability damages arising from the use of non-MAKITA spare parts.
Guarantee
MAKITA guarantees the highest quality and will therefore reimburse all costs for repair by replacement of damaged parts resulting
from material or production faults occurring within the guarantee period after purchase. Please note that in some countries particular
guarantee conditions may exist. If you have any questions, please contact your salesman, who is responsible for the guarantee of
the product.
Please note that we cannot accept any responsibility for damage caused by:
•
•
•
•
•
•
•
•
•
•
•
•
Disregard of the instruction manual.
Non-performance of the required maintenance and cleaning.
Incorrect carburetor adjustment.
Normal wear and tear.
Obvious overloading due to permanent exceeding of the upper performance limits.
The use of other than original MAKITA cutting discs.
Use of force, improper use, misuse or accidents.
Damage from overheating due to dirt on the fan housing.
Work on the Power Cut by unskilled persons or inappropriate repairs.
Use of unsuitable spare parts or parts which are not original MAKITA parts, insofar as they have caused the damage.
Use of unsuitable or old oil.
Damage related to conditions arising from lease or rent contracts.
Cleaning, servicing and adjustment work is not covered by the guarantee. All repairs covered by the guarantee must be performed
by a MAKITA service center.
ꢀ9
Download from Www.Somanuals.com. All Manuals Search And Download.
Troubleshooting
Malfunction
System
Observation
Cause
Cutting disc does not
start turning
Clutch
Engine runs
Damage to clutch
Cutting disc runs in idle
Carburetor,
clutch
Cutting disc runs
Incorrect idle speed,
blocked clutch
Engine does not start or
only with difficulty
Ignition system
Ignition spark
No ignition spark
Fuel tank is filled
Inside
Malfunction in fuel supply system, com-
pression system, mechanical malfunction.
Switch on STOP, fault or short-circuit in the
wiring, plug cap or spark plug defective.
Fuel supply
Choke in wrong position, carburetor defective,
suction head dirty, fuel line bent or interrupted.
Compression
system
Cylinder base packing ring defective, radial
shaft packings defective, cylinder or piston rings
defective
Outside
Spark plug does not seal.
Mechanical
malfunction
Starter does not engage
Spring in starter broken, broken parts
inside the engine.
Warm start difficulties
Carburetor
Fuel supply
Fuel tank is filled
Fuel tank is filled
Wrong carburetor adjustment.
Ignition spark
Engine starts, but
dies immediately
Wrong idling adjustment, suction head or
carburetor dirty.
Tank venting defective, fuel line interrupted,
cable defective, STOP switch defective.
Decompression valve dirty
Insufficient power
Several systems
may be involved
simultaneously
Engine is idling
Air filter dirty, wrong carburetor adjustment,
muffler clogged, exhaust channel in cylinder
clogged, spark arrester screen clogged.
ꢁ0
Download from Www.Somanuals.com. All Manuals Search And Download.
Extract from the spare parts list
Use only original MAKITA parts. For repairs and
replacement of other parts, see your MAKITA service center.
DPC7331HD
DPC7341HD
Pos. MAKITA-No. Qty. Denomination
Synthetic resin cutting disc
1
1
966 144 150
966 144 1ꢀ0
1
1
Cutting disc for steel,
dia. ꢁ50/ꢀ5,4 mm
Cutting disc for masonry,
dia. ꢁ50/ꢀ5,4 mm (14"/1.0")
ꢁ
4
5
6
8
9
994 ꢀ80 ꢀ50
965 ꢁ00 470
96ꢁ 601 1ꢀ1
010 114 091
ꢁ95 17ꢁ 0ꢀ0
ꢁ95 17ꢁ 010
1
1
1
1
1
1
1
1
1
1
1
ꢀ
1
1
1
1
1
Hex screw M8xꢀ5
V-belt
Suction head
Tank cap, compl. (fuel)
Inner filter
Air filter insert (paper cartridge)
Pre-filter (foam)
Spark plug
Starter cable ø 4.0x1000 mm
Starter grip
20
10 ꢁ95 17ꢁ 080
11 965 60ꢁ 0ꢀ1
1ꢀ 1ꢀꢀ 164 010
1ꢁ 001 161 0ꢀ0
14 ꢁ94 16ꢁ 0ꢀ0
15 9ꢀꢁ ꢀ08 004
16 941 719 140
17 940 8ꢀ7 000
18 944 ꢁ40 001
19 ꢁ94 174 140
ꢀ0 ꢁ94 174 ꢁ40
Return spring in housing
Hexagonal nut M8
Universal wrench SW 1ꢁ/19
Offset screwdriver Tꢀ7
Screwdriver (carburetor)
Spark arrester screen cpl.
Spark arrester screen cpl.
(for models with catalytic converter)
Accessories (not delivered with the Power Cut)
Diamond cutting disc 14"/1.0"
ꢀꢀ 966 ꢀ44 0ꢀ1
ꢀꢀ 966 ꢁ44 0ꢀ0
ꢀꢀ 966 ꢀ44 011
ꢀꢀ 966 ꢁ44 010
1
1
1
1
Concrete Standard, dia. ꢁ50/ꢀ5,4 mm (14"/1.0")
Concrete DiaDuran, dia. ꢁ50/ꢀ5,4 mm (14"/1.0")
Asphalt Standard, dia. ꢁ50/ꢀ5,4 mm (14"/1.0")
Asphalt DiaDuran, dia. ꢁ50/ꢀ5,4 mm (14"/1.0")
24 010 114 081
ꢀ5 700 ꢁ94 ꢁ55
ꢀ6 957 80ꢀ 600
ꢀ7 ꢁ94 ꢁ65 10ꢀ
ꢀ8 ꢁ94 114 ꢀ71
ꢀ9 ꢁ94 114 ꢀ40
ꢁ0 ꢁ94 114 ꢀꢁ0
ꢁ1 908 006 ꢁ55
ꢁꢀ 908 905 165
1
1
1
1
1
ꢀ
ꢀ
ꢀ
4
Angle fuel-tank filler neck, cpl.
Guide trolley DTꢀ000 cpl.
Pressure water tank, cpl.
Mains water connection, cpl.
Stand with rollers, complete
Bushing
Roller
Star-head screw
Star-head screw
-
-
-
949 000 0ꢁ5
980 008 6ꢀ7
980 008 628
1
1
1
Combined can (for 5l fuel, ꢀ.5l oil)
Filter cleaner (0.5l)
Air-filter oil (1l)
29
30
31
*
28
22
32
ꢁ1
Download from Www.Somanuals.com. All Manuals Search And Download.
Makita U.S.A., Inc.
149ꢁ0 Northam Street
La Mirada,
CA 906ꢁ8-575ꢁ
Download from Www.Somanuals.com. All Manuals Search And Download.
|